DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and AgaP_AGAP012428

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_001688571.1 Gene:AgaP_AGAP012428 / 5668381 VectorBaseID:AGAP012428 Length:279 Species:Anopheles gambiae


Alignment Length:241 Identity:74/241 - (30%)
Similarity:95/241 - (39%) Gaps:72/241 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 GKDSQGN------GSSSNS----KSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLS 359
            |||..||      |.||:|    |.|:.|||||..||..||:.|..:||||:.:|.::|..|.||
Mosquito     1 GKDEDGNSIKNGLGLSSSSGLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQDRMELANKLGLS 65

  Fly   360 EVQVKIWFQNRRAKWKRVKA--------------------GLTSHGLGRNGTTSGTKIVVPIPVH 404
            :.|||.|:||||.||||..|                    |....|.....|.||       |..
Mosquito    66 DTQVKTWYQNRRTKWKRQTAVGLELLAEAGNYAAFQRLYGGPPYIGAWPYPTPSG-------PPG 123

  Fly   405 VNRFAVRSQHQQ------LEKMC-------------------LSGPKPDLRKKLSAEAIGGFEKF 444
            .::.||.:.::.      |:|..                   .|||.|.|....|...:..:.:.
Mosquito   124 TSQSAVDAYYRHAAAAAALQKPLPYRMYPGVPTIGTLNPISGPSGPFPHLSASSSLSTLSSYYQA 188

  Fly   445 S-GSTNASS--------PSGGPVGLGVG-VGVGVGVGLGVSTPLSL 480
            : |...|.|        ||||...|..| ..||.|....:|...||
Mosquito   189 NCGQQPAGSLLQQPHQTPSGGSNQLRDGETSVGAGSQHDISNLNSL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 27/50 (54%)
AgaP_AGAP012428XP_001688571.1 Homeobox 29..81 CDD:278475 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.