DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and AgaP_AGAP004648

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_001688961.2 Gene:AgaP_AGAP004648 / 5667717 VectorBaseID:AGAP004648 Length:789 Species:Anopheles gambiae


Alignment Length:181 Identity:61/181 - (33%)
Similarity:82/181 - (45%) Gaps:36/181 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 SQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRA 372
            :|....:.|...||.|||:|:.||||||:|||..|||....|.:||.||.|:|.|||:||||||.
Mosquito   173 AQAEFVAENGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRM 237

  Fly   373 KWKRVKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQL---------EKMCLSG---P 425
            |.||.....|      :...||            :..::.:|:||         :|.| .|   |
Mosquito   238 KHKRQTLSKT------DDDESG------------KDDLKGEHEQLIGIVSDSNSKKSC-QGCELP 283

  Fly   426 KPDLRKKLSAEAIGGFEKFSGSTNASSPSGGPVGLGVGVGVGVGVGLGVST 476
            ..|:....|:..  |....:.:|..|||...|   ...:.:....|.|.||
Mosquito   284 SDDIPDSTSSSR--GMNNNTPNTGKSSPVMTP---NSTIDISTPTGGGGST 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 32/50 (64%)
AgaP_AGAP004648XP_001688961.2 Homeobox 188..240 CDD:278475 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.