powered by:
Protein Alignment unpg and nkx6.2
DIOPT Version :9
Sequence 1: | NP_477146.1 |
Gene: | unpg / 35942 |
FlyBaseID: | FBgn0015561 |
Length: | 485 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001129256.1 |
Gene: | nkx6.2 / 565782 |
ZFINID: | ZDB-GENE-070626-1 |
Length: | 278 |
Species: | Danio rerio |
Alignment Length: | 61 |
Identity: | 27/61 - (44%) |
Similarity: | 42/61 - (68%) |
Gaps: | 0/61 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 316 NSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376
:.|.:..|..|:.:|:..||:.|...|||:..||:::|.||.::|.|||:||||||.||::
Zfish 148 DGKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRK 208
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X14 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.