DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and gsx2

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001020683.1 Gene:gsx2 / 561076 ZFINID:ZDB-GENE-041001-114 Length:242 Species:Danio rerio


Alignment Length:223 Identity:74/223 - (33%)
Similarity:91/223 - (40%) Gaps:54/223 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 YVHSLSVHARLQHMAAAGRMHEDQANPGMAQ--LQEPTPPQAHSSPAKSGSHSPMEPALDVGMDE 247
            ||.||.:              :|.|.|.:::  .|:...|....||......:|:.|:...|.  
Zfish     6 YVDSLII--------------KDPARPTLSEHTAQDFLIPIGMHSPGVMSVTAPICPSRKTGT-- 54

  Fly   248 DFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQS---RHEGGG------- 302
              .|....|.. |...|||   |.:...:...:|..|:..|......||   .|.|.|       
Zfish    55 --FCVCPLCVS-SHIHSPR---GGIPLLKGQGFTAGDAAFCQRMAHQQSPALAHPGHGHAPVCTP 113

  Fly   303 ---------------MGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQI 352
                           :|..|   |....|.|  |.||||||.|||||||||.:..|||...|.:|
Zfish   114 TSFSVTDPRRYHCLSLGASD---NSHIQNGK--RMRTAFTSTQLLELEREFSSNMYLSRLRRIEI 173

  Fly   353 ATSLKLSEVQVKIWFQNRRAKWKRVKAG 380
            ||.|.|||.||||||||||.|.|:...|
Zfish   174 ATYLNLSEKQVKIWFQNRRVKHKKEGKG 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 36/50 (72%)
gsx2NP_001020683.1 COG5576 <132..242 CDD:227863 44/75 (59%)
Homeobox 144..196 CDD:278475 37/51 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.