DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and hoxb13a

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001038377.1 Gene:hoxb13a / 559921 ZFINID:ZDB-GENE-050812-1 Length:303 Species:Danio rerio


Alignment Length:328 Identity:79/328 - (24%)
Similarity:116/328 - (35%) Gaps:112/328 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 GYFAQNHERLTHLIAGGCYLPSSPAGHPA-------------AQQPQAQAQPQPPPPHPPTHALE 142
            |.||.|..|  :|:|     .|:.:|||:             :....|::..|..|         
Zfish    36 GNFAANQCR--NLMA-----HSALSGHPSSLVHGSSYPTVDVSTSSSAESGKQCTP--------- 84

  Fly   143 KQLPPTLPHPLDTRFLPFN-------PAAAG-------VAPTDLSYRRLAELMNQDYVHSLSVHA 193
               .||:|....|..:|:.       |...|       ..|:.|||  .||......|.|.....
Zfish    85 ---CPTVPQASSTGPIPYGYFGNSYYPCRMGRGSLKSCTQPSALSY--TAEKYMDTPVTSEEYPT 144

  Fly   194 RLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSD 258
            |.:..|.                       .||.|:   .:..|...|||.:.:... :|:...|
Zfish   145 RAKEFAF-----------------------YHSYPS---PYQSMASYLDVSVVQTLG-TGEPRHD 182

  Fly   259 ISLTMSPRNYNGEMDKSRNGAYTNSDSED--CSDDEG-------------AQSRHEGGGMGGKDS 308
            ..|         .||..:..|..|.....  ||.|:|             ...:|:||       
Zfish   183 SLL---------PMDSYQPWALANGWGSQMYCSKDQGQAGHLWKSALADVVAHQHDGG------- 231

  Fly   309 QGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAK 373
                  |..:.|::|..:|..||.|||:|:.|.|:::..:|.:|:....|||.|:.|||||||.|
Zfish   232 ------SFRRGRKKRIPYTKVQLKELEKEYAANKFITKDKRRKISAVTNLSERQITIWFQNRRVK 290

  Fly   374 WKR 376
            .|:
Zfish   291 EKK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 23/50 (46%)
hoxb13aNP_001038377.1 HoxA13_N 27..143 CDD:289085 29/127 (23%)
homeodomain 237..293 CDD:238039 25/55 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.