DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and hmx2

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001108570.3 Gene:hmx2 / 555632 ZFINID:ZDB-GENE-080506-2 Length:269 Species:Danio rerio


Alignment Length:208 Identity:61/208 - (29%)
Similarity:91/208 - (43%) Gaps:33/208 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 SSPAKSGSHSPMEPALDVGMDEDFECSGDS----CSDISLTMS-----PRNYNGEMDK------- 274
            |:...|....|.:..|.|..::|.....||    ||:..:..|     |.|:.....|       
Zfish    34 SAGKDSPKSQPRKRTLSVSSEDDCSAGEDSGDCYCSEPGVPESCNPHQPLNFCLGATKGLLPVQD 98

  Fly   275 --SRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELERE 337
              .|....|.|...|..:::|............:...|....:||..::.||.|:..|:.:||..
Zfish    99 GIDRRPHLTPSILPDYKEEQGRACSQMSPVSEDRQRDGPDKQNNSAKKKTRTVFSRSQVYQLEST 163

  Fly   338 FHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR-----VKAGLTSHGLGRNGTTSGTKI 397
            |..|:|||.:||:.:|:||:|:|.|||.||||||.||||     ::|...:|...:  |..|..:
Zfish   164 FDMKRYLSSSERACLASSLQLTETQVKTWFQNRRNKWKRQLSAELEAANMAHASAQ--TLVGMPL 226

  Fly   398 V--------VPIP 402
            |        ||:|
Zfish   227 VFRENSLLRVPVP 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 27/50 (54%)
hmx2NP_001108570.3 Homeobox 148..201 CDD:306543 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.