Sequence 1: | NP_477146.1 | Gene: | unpg / 35942 | FlyBaseID: | FBgn0015561 | Length: | 485 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001108570.3 | Gene: | hmx2 / 555632 | ZFINID: | ZDB-GENE-080506-2 | Length: | 269 | Species: | Danio rerio |
Alignment Length: | 208 | Identity: | 61/208 - (29%) |
---|---|---|---|
Similarity: | 91/208 - (43%) | Gaps: | 33/208 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 226 SSPAKSGSHSPMEPALDVGMDEDFECSGDS----CSDISLTMS-----PRNYNGEMDK------- 274
Fly 275 --SRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELERE 337
Fly 338 FHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR-----VKAGLTSHGLGRNGTTSGTKI 397
Fly 398 V--------VPIP 402 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
unpg | NP_477146.1 | Homeobox | 324..375 | CDD:278475 | 27/50 (54%) |
hmx2 | NP_001108570.3 | Homeobox | 148..201 | CDD:306543 | 28/52 (54%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |