DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and nkx3-1

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001373254.1 Gene:nkx3-1 / 555375 ZFINID:ZDB-GENE-081104-238 Length:185 Species:Danio rerio


Alignment Length:143 Identity:50/143 - (34%)
Similarity:70/143 - (48%) Gaps:32/143 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 MEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEG---AQSRH 298
            :|..|.:..|:..|   |||            |.|.|:..:.......::.|...||   :.:..
Zfish    13 IEDILSLKEDKKDE---DSC------------NAESDRDDSTDRQTDSADTCRTSEGKTVSSTEM 62

  Fly   299 EGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQV 363
            .|||              .|.:|.|.|||..|:||||::|..::|||..||:.:|::|.|:|.||
Zfish    63 TGGG--------------GKKKRSRAAFTHLQVLELEKKFSRQRYLSAPERTHLASALHLTETQV 113

  Fly   364 KIWFQNRRAKWKR 376
            ||||||||.|.||
Zfish   114 KIWFQNRRYKTKR 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 29/50 (58%)
nkx3-1NP_001373254.1 COG5576 15..>136 CDD:227863 49/141 (35%)
Homeobox 72..126 CDD:395001 30/53 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.