DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and barhl1b

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001018142.1 Gene:barhl1b / 553186 ZFINID:ZDB-GENE-060118-2 Length:323 Species:Danio rerio


Alignment Length:312 Identity:84/312 - (26%)
Similarity:121/312 - (38%) Gaps:54/312 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 PLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQH-MAAAGRMHEDQANPGMAQ 215
            ||:  |.|.:...:|.:......|...|...|...|.|:..:.||| ..:||......|:..:.:
Zfish    38 PLE--FSPRSDLESGCSSPPSPRRECVEDAAQRQGHPLAYASHLQHGPISAGSQPRTVASSFLIR 100

  Fly   216 -LQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGA 279
             :.....|.|..:|..|......|             :|...|.|:..:..:.::.....|....
Zfish   101 DILADCKPLAACAPYSSNGQPTQE-------------AGRLASKIADDLIEKIHSNSSSDSEYKV 152

  Fly   280 YTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYL 344
            ....|.|..|..:..|.|.:                  |.|:.|||||..||.:|||.|..:|||
Zfish   153 KEEGDREISSSRDSPQVRLK------------------KPRKARTAFTDHQLAQLERSFERQKYL 199

  Fly   345 SLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKA-GLTSHGLGRNGTTSGTKIVVPIPVHVNRF 408
            |:.:|.::|.||.|::.|||.|:||||.||||..| ||..  |...|..|..:.:.|.|.    |
Zfish   200 SVQDRMELAASLNLTDTQVKTWYQNRRTKWKRQTAVGLEL--LAEAGNYSALQRMFPSPY----F 258

  Fly   409 AVRSQHQQLEKMCL-------SGPKPDLRKKLSAEAIGGFEKFSGSTNASSP 453
            ..:|....|:....       |.|.|.|::.|....:     ..|...||.|
Zfish   259 YPQSLVSNLDPGAALYLYRGPSAPPPALQRPLVPRIL-----LHGLQGASEP 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 28/50 (56%)
barhl1bNP_001018142.1 Oxidoreductase_nitrogenase 48..>88 CDD:295466 10/39 (26%)
Homeobox 178..230 CDD:278475 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.