DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and barhl1a

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001017712.2 Gene:barhl1a / 550407 ZFINID:ZDB-GENE-050417-212 Length:299 Species:Danio rerio


Alignment Length:313 Identity:85/313 - (27%)
Similarity:130/313 - (41%) Gaps:74/313 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 SLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAK---SGSHSPMEP---------- 239
            |..:.:.|.|.|         ::|.|::.:..:|  |..||..   ||..||..|          
Zfish     8 SFGIESILSHRA---------SSPCMSKGECRSP--AELSPRSDLDSGCSSPPSPRRSSVEDAVQ 61

  Fly   240 --ALDVGMDEDFECSGD---------------SCSDISLTMSPRNYNGEMDKSRNGAYTNSDSED 287
              |..:|:|...:.|..               .|..:: ..:|.:..|:         :..|:||
Zfish    62 RRARALGLDSPLQISQQPRTVTSSFLIRDILADCKPLA-ACAPYSSTGQ---------SAQDAED 116

  Fly   288 CSD----DEGAQSRHEGGGMGGKDSQGNGSSSNS---KSRRRRTAFTSEQLLELEREFHAKKYLS 345
            |.|    :..:.|.:.......::...:..|.||   |.|:.|||||..||.:|||.|..:||||
Zfish   117 CMDKLHSNSSSDSEYRVKDEADREISSSRDSPNSRLKKPRKARTAFTDHQLAQLERSFERQKYLS 181

  Fly   346 LTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKA-GLTSHGLGRNGTTSGTKIVVPIPVHVNRFA 409
            :.:|.::|.||.|::.|||.|:||||.||||..| ||..  |...|..|..:.:.|.|.    |.
Zfish   182 VQDRMELAASLNLTDTQVKTWYQNRRTKWKRQTAVGLEL--LAEAGNYSALQRMFPSPY----FY 240

  Fly   410 VRSQHQQLEK---MCL----SGPKPDLRKKLSAEAIGGFEKFSGSTNASSPSG 455
            .:|....|:.   :.|    |.|.|.:::.|....:  .....|..:.:|.||
Zfish   241 PQSLVSNLDPGPGLYLYRGPSAPPPPVQRPLVPRIL--LHGLQGGGDPASLSG 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 28/50 (56%)
barhl1aNP_001017712.2 TPP_enzymes <122..177 CDD:294952 17/54 (31%)
Homeobox 159..211 CDD:278475 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.