DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and chst12

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001015949.1 Gene:chst12 / 548703 XenbaseID:XB-GENE-1014616 Length:420 Species:Xenopus tropicalis


Alignment Length:129 Identity:30/129 - (23%)
Similarity:45/129 - (34%) Gaps:56/129 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 WKRV-KAGLTSHGLGRNGTTSGTKIVVP---------IPVHVNRF---------------AVRSQ 413
            |..| .|.|..|       ||.:|.::|         :.|..|||               ..:|:
 Frog    26 WDNVGTANLNLH-------TSFSKSLLPQSSAELSTAVTVPRNRFVSDVDAFLDHFLNFSTKKSE 83

  Fly   414 HQ--QLEKMCLSGPKP----------DLRKKLSAEAIGGFE-----------KFSGSTNASSPS 454
            .|  :.|||.|.||..          ..::||. :||...|           :|.|:::.|.|:
 Frog    84 FQSTKAEKMPLRGPSSLEENVRGYDWSTKEKLE-DAILDQEIIQQERKRNLLQFCGNSSFSFPT 146

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity