DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and hoxb4

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001116487.1 Gene:hoxb4 / 548393 XenbaseID:XB-GENE-1033882 Length:234 Species:Xenopus tropicalis


Alignment Length:181 Identity:58/181 - (32%)
Similarity:85/181 - (46%) Gaps:60/181 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 CSDISLT------MSPRNYNGEMDKS--RNGA-YTNSDSE------DC--SDDEGAQSRHEGGGM 303
            |.:.|.|      .||..|.|:..:|  ::|| |:.|.|.      .|  |..:||:..|..|.:
 Frog    20 CEEYSHTDYLPSGHSPEYYGGQKRESSFQHGAPYSRSLSSSSAPYTSCQGSVRQGARLPHSSGLL 84

  Fly   304 GGK--------------------------DSQG-----------------NGSSSNSKSRRRRTA 325
            .|:                          ||.|                 :.:.|:.:::|.|||
 Frog    85 PGEKAHLESSITPTSPPSCSLIASDHKHPDSPGQDPVVYPWMKKAHISRASSTYSDGEAKRSRTA 149

  Fly   326 FTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376
            :|.:|:||||:|||..:||:...|.:||.:|:|||.|:||||||||.|||:
 Frog   150 YTRQQVLELEKEFHYNRYLTRRRRVEIAHTLRLSERQIKIWFQNRRMKWKK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 30/50 (60%)
hoxb4NP_001116487.1 Homeobox 146..200 CDD:365835 32/53 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.