DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and vtn

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001184007.1 Gene:vtn / 548363 XenbaseID:XB-GENE-989489 Length:447 Species:Xenopus tropicalis


Alignment Length:227 Identity:45/227 - (19%)
Similarity:67/227 - (29%) Gaps:98/227 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 SHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAY------------TNSDS 285
            |...:|......:.|.|....|:. |.:..:...||||     |..||            .|..|
 Frog   209 SDGVLESGYPRSISEGFHNIPDNI-DAAFALPANNYNG-----REKAYFFKGNRYWQYEFQNQPS 267

  Fly   286 -EDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTER 349
             .||.|  .|||                           ..|:              .|:||.:.
 Frog   268 WRDCQD--SAQS---------------------------DLFS--------------YYVSLQKD 289

  Fly   350 S-------QIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTSGTKIVVPIPVHVNR 407
            |       ...:|:|.|....  |:.|:  .||              |..:....|:|..::|.:
 Frog   290 SWEDFFSFLFGSSMKSSTEGP--WYINK--DWK--------------GVPNNVDAVLPSRIYVPK 336

  Fly   408 FAVRSQHQQLEKMCLSGPKPDLRKKLSAEAIG 439
            ...||:.::      |..:|..||     |:|
 Frog   337 QTRRSRRRK------SRRRPSRRK-----AVG 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 10/57 (18%)
vtnNP_001184007.1 SO 22..64 CDD:197571
HX 132..436 CDD:238046 45/227 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.