DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and NKX1-1

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001277008.1 Gene:NKX1-1 / 54729 HGNCID:24975 Length:448 Species:Homo sapiens


Alignment Length:471 Identity:122/471 - (25%)
Similarity:158/471 - (33%) Gaps:190/471 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 PSSPAGHPAAQQPQAQAQPQP---PPPHPPTHALEKQLP-----PTLPH----PL---DTRFLPF 160
            |.:|...||...|     |||   |.|..|..|.::.:.     |..|.    ||   ||  :|.
Human     6 PEAPGDIPALPPP-----PQPGSGPAPPAPAAAAQEAMDGRAELPAFPRAGAPPLAASDT--VPA 63

  Fly   161 NPAAAGVA-------PTDLSYRRLAELMNQDYVHSLSVHARL------------------QHMAA 200
            .|..||.|       ||..|   :.::::.:..:|......|                  ...||
Human    64 APEGAGAARPAAPLRPTSFS---VLDILDPNKFNSRRRRCVLLGPVAPAACAPCASAPCAPAPAA 125

  Fly   201 AGRMHEDQ-------ANPGMAQLQEPTPPQAHSSPAKS---------------GSHSPMEPALD- 242
            :||....:       |..|........||.| ..|.|:               |.|||...:.| 
Human   126 SGRPPRAEELERRALAGAGGVGAAGAEPPNA-GDPFKAGEAETNDTNGYSSGGGGHSPSADSGDE 189

  Fly   243 VGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNG--------------AYTNSDSEDCSDDEG 293
            |..|||     |...:...|.:.|.    .:::|.|              |.|::......|:..
Human   190 VPDDED-----DDEDEAPETEAARG----AEEARGGGGGLGARGSGCQGAAETDASPGATVDEAA 245

  Fly   294 AQSRHE---------GG----GMGGKDSQG-----------NGSSSNS-KSRRRRTAFTSEQLLE 333
            |....|         ||    |..|...||           .||.|.| |.||.|||||.|||:.
Human   246 APGPRENSPVAQGPPGGAAAPGGAGTTPQGTATAAKPKRKRTGSDSKSGKPRRARTAFTYEQLVA 310

  Fly   334 LEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTSGTKIV 398
            ||.:|.|.:|||:.||..:|.||.|:|.||||||||||.|||:...|                  
Human   311 LENKFKATRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPG------------------ 357

  Fly   399 VPIPVHVNRFAVRSQHQQLEKMCLSGPKPDLRKKLSAEAIGGFEKFSGSTNASSPSGGPVGLGVG 463
                                                             .:.|:|:||..|.|.|
Human   358 -------------------------------------------------ADTSAPTGGGGGPGPG 373

  Fly   464 VGVGVGVGLGVSTPLS 479
            .|.|.|:..|:| |||
Human   374 AGPGTGLPGGLS-PLS 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 32/50 (64%)
NKX1-1NP_001277008.1 Homeobox 300..352 CDD:278475 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.