DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Crxos

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001028810.1 Gene:Crxos / 546024 MGIID:2451355 Length:246 Species:Mus musculus


Alignment Length:45 Identity:22/45 - (48%)
Similarity:27/45 - (60%) Gaps:0/45 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 FTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNR 370
            |:.|||.|||..|..:.|..|.:|..:||.|||.|.||:.||..|
Mouse    20 FSWEQLSELEAYFKVEPYPDLQDRKIMATRLKLKEEQVEAWFIQR 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 22/45 (49%)
CrxosNP_001028810.1 Homeobox 20..61 CDD:278475 19/40 (48%)
homeodomain 127..179 CDD:238039
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.