DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and PAX4

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001353039.1 Gene:PAX4 / 5078 HGNCID:8618 Length:351 Species:Homo sapiens


Alignment Length:245 Identity:62/245 - (25%)
Similarity:90/245 - (36%) Gaps:56/245 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 PHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHAR---LQHMAAAGRMHEDQANP 211
            |.|||||......|.:|:.|.|:|  |:.::.|......|..:.|   |:.....|      :.|
Human    21 PLPLDTRQQIVRLAVSGMRPCDIS--RILKVSNGCVSKILGRYYRTGVLEPKGIGG------SKP 77

  Fly   212 GMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSR 276
            .:|     |||.........|..    |||.....:...|:...|:              .||:.
Human    78 RLA-----TPPVVARIAQLKGEC----PALFAWEIQRQLCAEGLCT--------------QDKTP 119

  Fly   277 NGAYTNSDSEDCSDDEG---------------AQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAF 326
            :.:..|.......:|:|               ..:.|.|.........|.|       .|.||.|
Human   120 SVSSINRVLRALQEDQGLPCTRLRSPAVLAPAVLTPHSGSETPRGTHPGTG-------HRNRTIF 177

  Fly   327 TSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376
            :..|...||:||...:|.....|.::||:..|.|..|::||.||||||:|
Human   178 SPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRAKWRR 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 21/50 (42%)
PAX4NP_001353039.1 PAX 5..129 CDD:128645 31/138 (22%)
Homeobox 174..226 CDD:306543 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.