DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Rhox8

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001020947.1 Gene:Rhox8 / 503423 RGDID:1561047 Length:178 Species:Rattus norvegicus


Alignment Length:236 Identity:53/236 - (22%)
Similarity:90/236 - (38%) Gaps:62/236 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 LEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMH 205
            :|.|......|..|.:....|.|||.:...|:..|...|:: |.|                 .|.
  Rat     1 MEPQEVTQYSHLRDDQIKESNEAAAWIVLQDIKEREEKEVV-QGY-----------------PML 47

  Fly   206 EDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNG 270
            :..|..|....:|.:..:.  :||.|.:.:.::                                
  Rat    48 DTTATEGEGANEEESRDEI--TPAGSSASASVD-------------------------------- 78

  Fly   271 EMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELE 335
              |:|::|..:::|     .|:|.|.....|...|..:........|::|.|   ||..||.|||
  Rat    79 --DRSQDGGTSSND-----QDKGQQKEPIPGSTKGHQASPRLPGQLSRNRHR---FTEFQLQELE 133

  Fly   336 REFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376
            |.|....|.|...|.::|..:.::|.:|:.||::||||:::
  Rat   134 RIFERNHYPSAAARRELARWIGVTESRVENWFKSRRAKYRK 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 21/50 (42%)
Rhox8NP_001020947.1 Homeobox 121..173 CDD:278475 23/54 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.