DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Lbx2

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001102714.1 Gene:Lbx2 / 500224 RGDID:1561172 Length:196 Species:Rattus norvegicus


Alignment Length:177 Identity:52/177 - (29%)
Similarity:75/177 - (42%) Gaps:52/177 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 PGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKS 275
            ||..  .||..|:|...||     ||:             |:.:.       ::.:.:.|...: 
  Rat    23 PGAP--SEPRLPEAGPDPA-----SPL-------------CALEE-------LASKTFQGHSPR- 59

  Fly   276 RNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHA 340
                     :...|:.........|.|.|.:           :.|:.|||||.:|:|||||.|..
  Rat    60 ---------APQPSEGRAVPEAPPGPGTGVR-----------RRRKSRTAFTPQQVLELERRFVF 104

  Fly   341 KKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR----VKAGLTS 383
            :|||:.:||..:|..|.|:..||..||||||||.||    ::|.|.|
  Rat   105 QKYLAPSERDGLAARLGLANAQVVTWFQNRRAKLKRDVEEMRADLAS 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 29/50 (58%)
Lbx2NP_001102714.1 Homeobox 86..139 CDD:278475 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.