DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Hoxa7

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001102703.2 Gene:Hoxa7 / 500126 RGDID:1587253 Length:229 Species:Rattus norvegicus


Alignment Length:98 Identity:41/98 - (41%)
Similarity:55/98 - (56%) Gaps:12/98 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 CSD-DEGAQSRHEGGGMGGKDSQGNGS--------SSNSKSRRRRTAFTSEQLLELEREFHAKKY 343
            ||| .:||..:.:.|.:.|   ....|        ||....:|.|..:|..|.||||:|||..:|
  Rat    92 CSDLAKGACDKADEGVLHG---PAEASFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRY 153

  Fly   344 LSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376
            |:...|.:||.:|.|:|.|:||||||||.|||:
  Rat   154 LTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 27/50 (54%)
Hoxa7NP_001102703.2 Homeobox 133..185 CDD:278475 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.