DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Hoxb5

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001178854.1 Gene:Hoxb5 / 497987 RGDID:1562292 Length:269 Species:Rattus norvegicus


Alignment Length:249 Identity:78/249 - (31%)
Similarity:98/249 - (39%) Gaps:75/249 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 SYRRLAELMNQDYVHS-----LSVH---ARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPA 229
            |||..|.:....|.::     |||:   |...|..|.|  ...:|.|  |..|||...||.||.:
  Rat    33 SYRDPAAMHTGSYGYNYNGMDLSVNRSSASSSHFGAVG--ESSRAFP--ASAQEPRFRQATSSCS 93

  Fly   230 KSGSHSPMEPALDVGMDEDFEC-SGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDD-E 292
            .|   ||          |...| :|||........||.:.......|.|  :|..|....|.: |
  Rat    94 LS---SP----------ESLPCTNGDSHGAKPSASSPSDQATPASSSAN--FTEIDEASASSEPE 143

  Fly   293 GAQSR-----------------------------------HEGGGMGGKDSQGNGSSSNSKSRRR 322
            .|.|:                                   |....|.|.|           .:|.
  Rat   144 EAASQLSSPSLARAQPEPMATSTAAPEGQTPQIFPWMRKLHISHDMTGPD-----------GKRA 197

  Fly   323 RTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376
            |||:|..|.||||:|||..:||:...|.:||.:|.|||.|:||||||||.|||:
  Rat   198 RTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 30/50 (60%)
Hoxb5NP_001178854.1 PRK07003 <67..>171 CDD:235906 30/122 (25%)
Homeobox 198..251 CDD:365835 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.