DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Hoxb7

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001017480.1 Gene:Hoxb7 / 497985 RGDID:1559918 Length:219 Species:Rattus norvegicus


Alignment Length:187 Identity:53/187 - (28%)
Similarity:78/187 - (41%) Gaps:49/187 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 SPMEPALDVGMDEDFECS------------GDSCSDI---SLTMSPRNYN---GEMDKSRNGAYT 281
            :|..|....|....|..|            |.|.:.:   ...:.|.::|   ...:::.:|.  
  Rat    37 NPQRPGYGAGPGAPFSASVQGLYSGGGGMAGQSAAGVYEAGYGLEPSSFNMHCAPFEQNLSGV-- 99

  Fly   282 NSDSEDCSDDEGAQSRHEGGGMGGKDSQGNG-------------SSSNSKSRRRRTAFTSEQLLE 333
                  |..|....:       |.|:.:.:.             .||.::.:|.|..:|..|.||
  Rat   100 ------CPGDPAKAA-------GAKEQRDSDLAAESNFRIYPWMRSSGTERKRGRQTYTRYQTLE 151

  Fly   334 LEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNG 390
            ||:|||..:||:...|.:||.:|.|:|.|:||||||||.|||  |...|| |.|..|
  Rat   152 LEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWK--KENKTS-GPGTTG 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 27/50 (54%)
Hoxb7NP_001017480.1 Antp-type hexapeptide 126..131 0/4 (0%)
Homeobox 141..193 CDD:278475 28/51 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..219 7/16 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.