DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and alx4b

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001297007.1 Gene:alx4b / 497424 ZFINID:ZDB-GENE-050208-140 Length:259 Species:Danio rerio


Alignment Length:290 Identity:55/290 - (18%)
Similarity:80/290 - (27%) Gaps:126/290 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 ANPGMAQLQEPTPPQAHSS----------PAKSGSH-----SPME---PALDVGMDEDFECSGDS 255
            |.||..::|:..|.:...|          |||..::     ||..   |.||             
Zfish    22 AAPGQGRVQQANPYRTFQSSDSKYSPTFLPAKGQTYGEKPRSPFHQDCPTLD------------- 73

  Fly   256 CSDISLTMSPRNYNGEMDKSRNGAYT-----------NSDSEDCSDDEGAQSRHEGGGMGGKDSQ 309
                             |.:..|||:           .|.|||...::||..          ...
Zfish    74 -----------------DSTAEGAYSKYHLFMQRPACKSPSEDSKLEDGALI----------SCY 111

  Fly   310 GNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKW 374
            |..|.|..|.|:|.   ...|:.::...|.....|.|..|.:     ..:::|...|.       
Zfish   112 GVVSESPGKWRKRE---RFGQMQQVRTHFSTAYELPLLTRPE-----NYAQIQNPSWL------- 161

  Fly   375 KRVKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLSGPKPDLRKKLSAEAIG 439
                              ||:....|:|..|......|.       |:: |.|.     ||..:.
Zfish   162 ------------------SGSSSASPVPGCVVPCDTVSS-------CMT-PHPH-----SASGVS 195

  Fly   440 GF-----------EKFSGSTNASSPSGGPV 458
            .|           :...||...||..||.:
Zfish   196 DFLGMPSPGGSMAQTHMGSLFGSSGVGGTI 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 7/50 (14%)
alx4bNP_001297007.1 OAR 235..252 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.