DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment unpg and lum

DIOPT Version :9

Sequence 1:	NP_477146.1	Gene:	unpg / 35942	FlyBaseID:	FBgn0015561	Length:	485	Species:	Drosophila melanogaster
Sequence 2:	NP_001011006.1	Gene:	lum / 496415	XenbaseID:	XB-GENE-1004934	Length:	353	Species:	Xenopus tropicalis

Alignment Length:	111	Identity:	24/111 - (21%)
Similarity:	37/111 - (33%)	Gaps:	28/111 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly   367 FQN-RRAKWKRVKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLSGPKP--- 427
            |:| ...||..:.....::|..:....|..|.:|.:.:..|....           |.||.|
Frog    99 FKNVTELKWLILDHNQLTNGKIKKNAFSSLKHLVKLYISFNNLTE-----------LVGPLPKTM 152

  Fly   428 -DLR------KKLSAEAIGGFEKFS------GSTNASSPSGGPVGL 460
             |||      .|::...:.|.|..:      .:....|.||...||
Frog   153 DDLRVTNNKISKITPNILEGLENLTHIHLQYNALKEDSISGAFKGL 198

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
unpg	NP_477146.1	Homeobox	324..375	CDD:278475	3/8 (38%)
lum	NP_001011006.1	PRK15370	<56..>256	CDD:185268	24/111 (22%)
		leucine-rich repeat	81..104	CDD:275380	2/4 (50%)
		leucine-rich repeat	105..130	CDD:275380	4/24 (17%)
		leucine-rich repeat	131..151	CDD:275380	6/30 (20%)
		leucine-rich repeat	152..175	CDD:275380	5/22 (23%)
		leucine-rich repeat	176..200	CDD:275380	5/23 (22%)
		leucine-rich repeat	201..221	CDD:275380
		leucine-rich repeat	222..245	CDD:275380
		PLN03150	<235..>307	CDD:178695
		leucine-rich repeat	246..270	CDD:275380
		leucine-rich repeat	271..294	CDD:275380
		leucine-rich repeat	295..320	CDD:275380
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0489
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X14
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.900