DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and NKX6-1

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_006159.2 Gene:NKX6-1 / 4825 HGNCID:7839 Length:367 Species:Homo sapiens


Alignment Length:422 Identity:88/422 - (20%)
Similarity:129/422 - (30%) Gaps:185/422 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERPALLQNGEIGTMESPTTRLASKPFP--KPFSIESLIANQTPATATPP---------SPPEER 54
            :..|.|.....:..|::|....|..|.|  .|.|..|..::.:|   :||         .||...
Human    17 LSSPPLAALHSMAEMKTPLYPAAYPPLPAGPPSSSSSSSSSSSP---SPPLGTHNPGGLKPPATG 78

  Fly    55 DQEQEAEQEQELSARAMVASSALGLTQFPLYNPWLHGYFAQNHERLTHLIAGGCYLPS-SPAGHP 118
            .........|:||     |::..|:... |..|.:.             :|.|..||| ||:|..
Human    79 GLSSLGSPPQQLS-----AATPHGINDI-LSRPSMP-------------VASGAALPSASPSGSS 124

  Fly   119 AAQQPQAQAQP-------------------------------QPPPPHPPTHALEKQLPPTLPHP 152
            ::....|.|..                               .||||.|.               
Human   125 SSSSSSASASSASAAAAAAAAAAAAASSPAGLLAGLPRFSSLSPPPPPPG--------------- 174

  Fly   153 LDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQ 217
                 |.|:|:||.||......:.||||..:..:..                      ||:.|  
Human   175 -----LYFSPSAAAVAAVGRYPKPLAELPGRTPIFW----------------------PGVMQ-- 210

  Fly   218 EPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTN 282
              :||                                 ..|..|..:|                 
Human   211 --SPP---------------------------------WRDARLACTP----------------- 223

  Fly   283 SDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLT 347
                           |:|..:..||         .|.:..|..|:.:|:..||:.|...|||:..
Human   224 ---------------HQGSILLDKD---------GKRKHTRPTFSGQQIFALEKTFEQTKYLAGP 264

  Fly   348 ERSQIATSLKLSEVQVKIWFQNRRAKWKRVKA 379
            ||:::|.||.::|.|||:||||||.||::..|
Human   265 ERARLAYSLGMTESQVKVWFQNRRTKWRKKHA 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 24/50 (48%)
NKX6-1NP_006159.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..133 27/118 (23%)
Repressor domain. /evidence=ECO:0000250 102..268 52/298 (17%)
Homeobox 239..293 CDD:395001 26/53 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..367 1/3 (33%)
Involved in DNA-binding. /evidence=ECO:0000250 306..367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.