DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and hbn

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster


Alignment Length:271 Identity:73/271 - (26%)
Similarity:97/271 - (35%) Gaps:68/271 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 PFNPAAAGVAPTDLS--------YRRLAELMNQDYV-------HSLSVHARLQHMAAAGRMHEDQ 208
            |..|.|...||...|        |.....|.||..:       ..|..|....|......:|...
  Fly    14 PIMPPAMRPAPVQESPVSRPRAVYSIDQILGNQHQIKRSDTPSEVLITHPHHGHPHHIHHLHSSN 78

  Fly   209 ANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDV-GMDEDFECSGDSCSDISLTMSPRNYNGEM 272
            :| |...|.. ...|.||...........:..|.| ...||               ||.|.:|.:
  Fly    79 SN-GSNHLSH-QQQQQHSQQQHHSQQQQQQQQLQVQAKRED---------------SPTNTDGGL 126

  Fly   273 DKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELERE 337
            |..             :|||.:.|.:.|..:...:..       .|.||.||.||:.||.:|||.
  Fly   127 DVD-------------NDDELSSSLNNGHDLSDMERP-------RKVRRSRTTFTTFQLHQLERA 171

  Fly   338 FHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR-------VKAG--LTSHGLGRNGTTS 393
            |...:|..:..|..:|..|.|||.:|::|||||||||::       .|||  |...||..     
  Fly   172 FEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKREKFMNQDKAGYLLPEQGLPE----- 231

  Fly   394 GTKIVVPIPVH 404
             ..:.:|:|.|
  Fly   232 -FPLGIPLPPH 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 25/50 (50%)
hbnNP_788420.1 Homeobox 156..209 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.