DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and AgaP_AGAP001495

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_001238516.3 Gene:AgaP_AGAP001495 / 4577217 VectorBaseID:AGAP001495 Length:230 Species:Anopheles gambiae


Alignment Length:155 Identity:56/155 - (36%)
Similarity:71/155 - (45%) Gaps:22/155 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 SQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRA 372
            :.|:..||.||.||.||.|.|.||.||||.|.|..|..:..|..:|..|.|.|.:|.:|||||||
Mosquito    10 ADGDDESSASKRRRSRTNFNSWQLEELERAFSASHYPDVFMREALAMRLDLKESRVAVWFQNRRA 74

  Fly   373 KWKRVKAGLTSHGLGRNG------TTSGTKIVVPIP---------VHVNRFAVRSQHQQLEKMCL 422
            ||:  |...|..|.||..      :.||.    |||         ....:...::..:|..|:..
Mosquito    75 KWR--KKEHTKKGPGRPAHNAHPQSCSGE----PIPPSELRAREKARRRKKIAKALERQARKLRA 133

  Fly   423 SGPKPDLRKKLSAEAIGGFEKFSGS 447
            .|...|| :.|.||.:......|||
Mosquito   134 KGITVDL-EALKAEYLSQHRNNSGS 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 26/50 (52%)
AgaP_AGAP001495XP_001238516.3 Homeobox 26..77 CDD:278475 26/50 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.