DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and E5

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster


Alignment Length:394 Identity:93/394 - (23%)
Similarity:121/394 - (30%) Gaps:173/394 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GTMESPTTRLASKPFPKPFSIESLIANQTPATAT------PPSPPEERDQEQEAEQEQELSARAM 71
            ||...||   ..:|.|.|....:||.|:|...|.      ||.||        ::....|:|:..
  Fly   148 GTGNPPT---LIRPLPLPAPNLALIGNRTSPNAMAVRMAGPPHPP--------SQPPPFLAAQFQ 201

  Fly    72 VASSALGLTQFPLYNPWLHGYFAQNHERLTHLIAGGCYLPSSPAGHPAAQQPQAQAQPQPPPPHP 136
            :|::                 .|.:|:                      ||.|.|.|..||.|..
  Fly   202 MAAA-----------------LAHHHQ----------------------QQQQQQQQQLPPVPTG 227

  Fly   137 PTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAA 201
            |.|.         |||    .||......|:.|                                
  Fly   228 PPHG---------PHP----HLPPGQIPLGIFP-------------------------------- 247

  Fly   202 GRMHEDQANPGMAQLQEPTPPQAH----SSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLT 262
            |..|     ||     .| ||..|    |:|.......|:.|.|                     
  Fly   248 GGPH-----PG-----HP-PPHGHHPFGSAPHLIRDSYPLYPWL--------------------- 280

  Fly   263 MSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFT 327
                       .||:|...              .|..|..:         .....|.:|.||||:
  Fly   281 -----------LSRHGRIF--------------PRFPGNFL---------FQPFRKPKRVRTAFS 311

  Fly   328 SEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRV--KAGLTSHGLGRNG 390
            ..|||:||..|....|:...||.|:|..|.|:|.|||:||||||.|.||:  :.|..|......|
  Fly   312 PTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKRMQQEGGDGSDTKSNKG 376

  Fly   391 TTSG 394
            ::||
  Fly   377 SSSG 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 27/50 (54%)
E5NP_524825.1 Homeobox 307..359 CDD:278475 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
43.920

Return to query results.
Submit another query.