DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and hoxc8

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001006787.1 Gene:hoxc8 / 448482 XenbaseID:XB-GENE-480999 Length:242 Species:Xenopus tropicalis


Alignment Length:167 Identity:46/167 - (27%)
Similarity:66/167 - (39%) Gaps:37/167 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 HSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRN--YNGEMDKSRNGAYTNSDSED 287
            |.|.:.|.|.....|..       ..|.||:.........||.  |..:.:.|      .....|
 Frog    62 HGSSSLSNSGFQQNPCA-------LTCHGDASKFYGYEALPRQSLYGAQQEAS------VVQYPD 113

  Fly   288 CSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKS-------------RRRRTAFTSEQLLELEREFH 339
            |.......:         .:.||:.:.::|.|             |..|..::..|.||||:||.
 Frog   114 CKSSSNTNT---------SEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFL 169

  Fly   340 AKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376
            ...||:...|.:::.:|.|:|.||||||||||.|||:
 Frog   170 FNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 24/50 (48%)
hoxc8NP_001006787.1 Homeobox 153..206 CDD:365835 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.