DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and pax3

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_012825755.1 Gene:pax3 / 448464 XenbaseID:XB-GENE-482740 Length:486 Species:Xenopus tropicalis


Alignment Length:255 Identity:64/255 - (25%)
Similarity:98/255 - (38%) Gaps:76/255 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 YTNSDSEDCSDDEGAQ------SRHEGGGM------GGKDSQGNGSSSNS--------KSRRRRT 324
            :...|.||...|...|      ::|...|:      ...:|: .||..:|        |.||.||
 Frog   163 FGKGDEEDIELDRKEQEESEKRAKHSIDGILRERAPASPESE-EGSDIDSEPDLPLKRKQRRSRT 226

  Fly   325 AFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAG--------- 380
            .||:|||.||||.|....|..:..|.::|...||:|.:|::||.||||:|:: :||         
 Frog   227 TFTAEQLEELERAFERTHYPDIYTREELAQRAKLTEARVQVWFSNRRARWRK-QAGANQLMAFNH 290

  Fly   381 -------------LTSHGLGRNGTTSGTKIVVP----------------IPVHVNRFAVRSQHQQ 416
                         |.::.|..   ||.....:|                .|..|::.::.|..:.
 Frog   291 LIPGAFPPAAMPALPTYQLSE---TSYQPTSIPQAVSDPSNTVHRPQPLPPSSVHQSSLPSNPES 352

  Fly   417 LEKMCLSGPKPDLRKKLSAEAIGGFEKFSGSTNASSPSGGPVGLGVGVGVGVGVGLGVST 476
            ....||    |..|.        ||..::.|....|....|:...:|.|:...| :|:.|
 Frog   353 SSAYCL----PSGRH--------GFSSYTDSFVPPSGPSNPMNPAIGNGLSPQV-MGLLT 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 24/50 (48%)
pax3XP_012825755.1 PAX 35..162 CDD:238076
Homeobox 224..278 CDD:365835 26/53 (49%)
Pax7 349..393 CDD:372070 11/55 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.