DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and dlx5

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001004778.1 Gene:dlx5 / 447997 XenbaseID:XB-GENE-853057 Length:289 Species:Xenopus tropicalis


Alignment Length:250 Identity:67/250 - (26%)
Similarity:93/250 - (37%) Gaps:84/250 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 HPPTHALEKQLPPTLPHPLDTRFLPFNP-AAAG------VAPTDLSYRRLAELMNQDYVHSLSVH 192
            ||      .|..||||....|....::| .|||      .:||..:|.:........| |.::  
 Frog    23 HP------SQDSPTLPESTATDSGYYSPGGAAGHPHHGYCSPTSATYGKALNAYQYQY-HGMN-- 78

  Fly   193 ARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCS 257
                  .|||..                |.:|:|.   .|..||..|                  
 Frog    79 ------GAAGNY----------------PGKAYSD---YGYGSPYHP------------------ 100

  Fly   258 DISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRR 322
                           ....:||| |......|..|...|..|...:.||.         .|.|:.
 Frog   101 ---------------HHQYSGAY-NRVQPPSSQPEKEVSEPEVRMVNGKP---------KKIRKP 140

  Fly   323 RTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRV 377
            ||.::|.||..|:|.|...:||:|.||:::|.||.|::.||||||||:|:|.|::
 Frog   141 RTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKI 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 26/50 (52%)
dlx5NP_001004778.1 DLL_N 26..118 CDD:315147 30/153 (20%)
Homeobox 140..193 CDD:306543 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.