DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and toy

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster


Alignment Length:449 Identity:100/449 - (22%)
Similarity:154/449 - (34%) Gaps:135/449 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 LHGYFAQNHERLTHLIAGGCYLPSSPAGHPAAQQ---PQAQAQPQPPPPHPPTHALEKQLPPTLP 150
            :||:   .|..:......||    |.|||....|   .....:|.|    ..|.....:|..:..
  Fly     9 MHGH---PHSSVGQSTLFGC----STAGHSGINQLGGVYVNGRPLP----DSTRQKIVELAHSGA 62

  Fly   151 HPLD-TRFL------------------PFNPAAAG-----VAPTDL-----SYRR---------- 176
            .|.| :|.|                  ...|.|.|     ||.|.:     .|:|          
  Fly    63 RPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECPSIFAWEI 127

  Fly   177 ----LAE-LMNQDYVHSL-SVHARLQHMAAAGRMHEDQANPG----MAQLQEPTPPQAHSSPAKS 231
                |:| :.|.|.:.|: |::..|:::|:.......|.|..    :......|...|......:
  Fly   128 RDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQTGGWAWYPSNTT 192

  Fly   232 GSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDK----SRNGAYTNSDSEDCSDDE 292
            .:|..:.||                  .|:..||.|.:|:.|:    .|...::...|...|.|.
  Fly   193 TAHLTLPPA------------------ASVVTSPANLSGQADRDDVQKRELQFSVEVSHTNSHDS 239

  Fly   293 GAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLK 357
            .:....|....|.:|||.. .....|.:|.||:|::||:..||:||....|..:..|.::|..:.
  Fly   240 TSDGNSEHNSSGDEDSQMR-LRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIG 303

  Fly   358 LSEVQVKIWFQNRRAKWKRVK--------------AGLTSHGLGRNGTTSGTKIVV---PIPVHV 405
            |.|.::::||.||||||:|.:              :|.||.....:|||:.:.:..   ..|..|
  Fly   304 LPEARIQVWFSNRRAKWRREEKMRTQRRSADTVDGSGRTSTANNPSGTTASSSVATSNNSTPGIV 368

  Fly   406 NRFAVRSQHQQLEKMCLSGPKPDLRKKLSAEAIGGFEKFSG---STNASSPSGGPVGLG 461
            |                             .||...|:.|.   |.:....|.||..||
  Fly   369 N-----------------------------SAINVAERTSSALVSNSLPEASNGPTVLG 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 20/50 (40%)
toyNP_001368990.1 PAX 29..153 CDD:128645 25/127 (20%)
COG5576 <253..368 CDD:227863 35/115 (30%)
Homeobox 269..322 CDD:395001 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.