DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and ey

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster


Alignment Length:328 Identity:88/328 - (26%)
Similarity:136/328 - (41%) Gaps:62/328 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 AAGVAPTDLSYRRLAELMNQ--DYVHSLSVHARLQH-MAAAGRMHEDQANPGMAQLQEPTPPQAH 225
            |||..|  |...|.|.|:.|  :::.:.|.|.:|.| ...|.:.|:          |:..||:.:
  Fly   313 AAGPGP--LEPARAAPLVGQSPNHLGTRSSHPQLVHGNHQALQQHQ----------QQSWPPRHY 365

  Fly   226 SSP--AKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRN---YNGEMDKSRNGAYTNSDS 285
            |..  ..|.|..|:..|.::.....: .||.|   ::.::||.|   ....:...||......|.
  Fly   366 SGSWYPTSLSEIPISSAPNIASVTAY-ASGPS---LAHSLSPPNDIESLASIGHQRNCPVATEDI 426

  Fly   286 EDCSDDEGAQSRHEGGGMGGKDSQGNGSSSN--------------SKSRRRRTAFTSEQLLELER 336
            ....:.:|.||...|.|.|   ...||.:||              .|.:|.||:||::|:..||:
  Fly   427 HLKKELDGHQSDETGSGEG---ENSNGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEK 488

  Fly   337 EFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVK----AGLTSHGLGRNGTTSGTKI 397
            ||....|..:..|.::|..:.|.|.::::||.||||||:|.:    ...|.:..|.:.|:|.|..
  Fly   489 EFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRRTPNSTGASATSSSTSA 553

  Fly   398 VVPIPVHVNRFAVRSQHQQLEKMCLSGPKPDLRKKLSAEAIGGFEKFSG-STNASSPSGGPVGLG 461
            ...:....|..:..|   .|......||        |...|.|....|. |||.::|:     ||
  Fly   554 TASLTDSPNSLSACS---SLLSGSAGGP--------SVSTINGLSSPSTLSTNVNAPT-----LG 602

  Fly   462 VGV 464
            .|:
  Fly   603 AGI 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 20/50 (40%)
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 21/51 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.