DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and meox1

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001002450.2 Gene:meox1 / 436723 ZFINID:ZDB-GENE-040718-149 Length:253 Species:Danio rerio


Alignment Length:171 Identity:64/171 - (37%)
Similarity:82/171 - (47%) Gaps:27/171 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 PQAHSSPAKS-GSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRN----GAYT 281
            |:.||...:: ...||.||.   |..:: .|.|          :......|||.:..    ||.|
Zfish    76 PETHSGYQRTEWQFSPCEPR---GRGQE-PCQG----------AAEAVGAEMDSAGGDRLAGAVT 126

  Fly   282 NSDSEDCS-------DDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFH 339
            .....|.|       |.|...|:.:......:||... :.||.|:|:.|||||.|||.|||.||.
Zfish   127 GCLEGDYSPQSVPAVDTEKKSSKRKREVTDIQDSSFK-ADSNCKARKERTAFTKEQLRELEAEFT 190

  Fly   340 AKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAG 380
            ...||:...|.:||.:|.|:|.|||:||||||.||||||.|
Zfish   191 HHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVKGG 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 30/50 (60%)
meox1NP_001002450.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..158 3/21 (14%)
Homeobox 174..226 CDD:278475 31/51 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..253 5/6 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.