DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and lbe

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster


Alignment Length:536 Identity:124/536 - (23%)
Similarity:179/536 - (33%) Gaps:211/536 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RPALLQNGEIGTMESPT---TRLASKPFPKPFSIESLIANQTPATATPPSPPEERDQEQEAEQEQ 64
            |||.....||....:|:   |:..:.|...|..:      |.|..:|     .:..|:|:...:.
  Fly     8 RPASPAESEISVGGAPSPLPTQHHTHPHSHPHPL------QHPRAST-----IDLLQQQQLLMQH 61

  Fly    65 ELSARAMVASSALGLTQFPLYN-PWLHGYF---------AQNHERLTHLIAGGCYLPSSPAGHPA 119
            ..:|.|..|::|.|||:..:.| |  ..||         :.:.|...|       .||.|:..|.
  Fly    62 HAAAAAAAAAAASGLTRSAVGNLP--EDYFHPLKRLRMSSSSSEPRDH-------TPSPPSAVPE 117

  Fly   120 AQ------------------------QPQAQAQPQPPP-----------PHPPTHALEKQLPPTL 149
            .|                        :.|.:....|||           |..|:..|   |.|. 
  Fly   118 PQTNQTTKSAIEGVKSFSIADILGHSEKQREESVSPPPNANLLAPPASRPIAPSGGL---LQPR- 178

  Fly   150 PHPLDTRFLPFNPAAAG---------VAPTD-----------------LSY-RRLAELMNQDYVH 187
            ..|||.     :||||.         |.|.|                 |.| :|||    .||..
  Fly   179 TEPLDV-----HPAAAAAMLLPSGQIVRPWDHLLGPTMPVRPFIPSALLHYEQRLA----LDYHR 234

  Fly   188 SLSVHAR-----LQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEP-------- 239
            .|..|..     |:||.         .||.:...::.:..::..|.:.:||.....|        
  Fly   235 QLQEHFNAQAQLLRHMG---------MNPAIIASEDGSSERSQRSSSSNGSTECCSPRQAEKLEK 290

  Fly   240 -ALDVGMDE------------DFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDD 291
             ....|.:|            ..:.:||:..|....|:.::::...|||....::|....     
  Fly   291 LTTQEGSEEAQKKKSEEQPTGSGKSNGDTPLDALFQMTTKDFDESQDKSHLDIFSNRPQP----- 350

  Fly   292 EGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSL 356
                                     .|.|:.|||||:.|:.|||:.|..:||||..:|.:||.||
  Fly   351 -------------------------KKKRKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASL 390

  Fly   357 KLSEVQVKIWFQNRRAKWKR-----------VKAGLTSH------------------------GL 386
            .||..||..||||||||.||           ||. .::|                        ||
  Fly   391 GLSNAQVITWFQNRRAKQKRDIEELKKDFDSVKV-FSAHKSFLENVNDLSILKKKPMHESDMVGL 454

  Fly   387 GRNGTTSGTKIVVPIP 402
            ......:|  :|||:|
  Fly   455 AAAAAAAG--MVVPVP 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 30/50 (60%)
lbeNP_524435.2 Homeobox 356..410 CDD:395001 31/53 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.