DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Dfd

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_477201.1 Gene:Dfd / 40832 FlyBaseID:FBgn0000439 Length:586 Species:Drosophila melanogaster


Alignment Length:478 Identity:108/478 - (22%)
Similarity:162/478 - (33%) Gaps:176/478 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 YFAQNHERLTHLIAGGCYLP-----SSPAGHPAA-----QQPQAQAQPQPPPPHPPTHALEKQLP 146
            |.|.:|...:|..:....||     |:.:||..|     ....|.|   .||.||.:|      |
  Fly    89 YMAHHHNPHSHSHSHTHSLPHHHSNSAISGHHQASAGGYSSNYANA---TPPSHPHSH------P 144

  Fly   147 PTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANP 211
            ...||                  ..|.|          |||    ||  ....:||.:|.|..|.
  Fly   145 HAHPH------------------QSLGY----------YVH----HA--PEFISAGAVHSDPTNG 175

  Fly   212 GMAQLQEP--------------------------------------------TPPQAHSSPAK-- 230
            .......|                                            |..|.||..::  
  Fly   176 YGPAANVPNTSNGGGGGGSGAVLGGGAVGGSANGYYGGYGGGYGTANGSVGSTHSQGHSPHSQMM 240

  Fly   231 ------SGSHSPMEPAL---DVGMD-----EDFECSGDSCSDISLTMSPRNYNGE---------- 271
                  |.:..|...||   ::|:.     |:...:|....::.:.:...:...|          
  Fly   241 DLPLQCSSTEPPTNTALGLQELGLKLEKRIEEAVPAGQQLQELGMRLRCDDMGSENDDMSEEDRL 305

  Fly   272 -MDKSRNGAYTNSDSEDCSD---DEGAQSR---------------HEGGGMGGKDSQGNGSSSNS 317
             :|:|.:...:|.:.:|..|   ||...:.               |..|...|....|      .
  Fly   306 MLDRSPDELGSNDNDDDLGDSDSDEDLMAETTDGERIIYPWMKKIHVAGVANGSYQPG------M 364

  Fly   318 KSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR------ 376
            :.:|:|||:|..|:||||:|||..:||:...|.:||.:|.|||.|:||||||||.|||:      
  Fly   365 EPKRQRTAYTRHQILELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKWKKDNKLPN 429

  Fly   377 ----VKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLSGPKPDLRKKL---S 434
                .|..:.::|   |.|....|   |.....::...::|.||..:...:...|.:.:.:   |
  Fly   430 TKNVRKKTVDANG---NPTPVAKK---PTKRAASKKQQQAQQQQQSQQQQTQQTPVMNECIRSDS 488

  Fly   435 AEAIGGFEKFSGSTNASSPSGGP 457
            .|:||         :.||..|.|
  Fly   489 LESIG---------DVSSSLGNP 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 30/50 (60%)
DfdNP_477201.1 Homeobox 370..422 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.