DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and bcd

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster


Alignment Length:353 Identity:80/353 - (22%)
Similarity:104/353 - (29%) Gaps:177/353 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 QPPPP-----HPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSL 189
            ||||.     ||..|......|.:.|||                                  || 
  Fly     3 QPPPDQNFYHHPLPHTHTHPHPHSHPHP----------------------------------HS- 32

  Fly   190 SVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGD 254
            ..|...||                .|||  .|||..:             ..|:..||       
  Fly    33 HPHPHHQH----------------PQLQ--LPPQFRN-------------PFDLLFDE------- 59

  Fly   255 SCSDISLTMSPRNYN-------GEMDKSRNGAYTNSD---SEDCSDDEGAQSRHEGGGMGGKDSQ 309
                   .....|||       .:|.|        .|   ||:..|                   
  Fly    60 -------RTGAINYNYIRPYLPNQMPK--------PDVFPSEELPD------------------- 90

  Fly   310 GNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKW 374
               |....:.||.||.|||.|:.|||:.|...:||:....:.::..|.|...||||||:|||.:.
  Fly    91 ---SLVMRRPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRH 152

  Fly   375 KRVKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRS-QH--QQLEKMCLSGPKPDLRK----- 431
            |                                  ::| ||  |..|.|.||   |.:::     
  Fly   153 K----------------------------------IQSDQHKDQSYEGMPLS---PGMKQSDGDP 180

  Fly   432 -KLSAEAIGGFEKFSGST-NASSPSGGP 457
             .|...::||     |:| ||.:||..|
  Fly   181 PSLQTLSLGG-----GATPNALTPSPTP 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 22/50 (44%)
bcdNP_788587.1 Homeobox 106..153 CDD:278475 19/46 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.