DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and pb

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster


Alignment Length:197 Identity:62/197 - (31%)
Similarity:83/197 - (42%) Gaps:40/197 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 KDSQGNGSSSNSKS---------RRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEV 361
            |.|..|....||.:         ||.|||:|:.||||||:|||..|||....|.:||.||.|:|.
  Fly   176 KSSNNNNQGDNSITEFVPENGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTER 240

  Fly   362 QVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLE------KM 420
            |||:||||||.|.||.....|..                   ..|:.:::....|.:      |.
  Fly   241 QVKVWFQNRRMKHKRQTLSKTDD-------------------EDNKDSLKGDDDQSDSNSNSKKS 286

  Fly   421 CLSG---PKPDLRKKLSAEAIGGFEKFSGSTNASSPSGGPVGLGVGVGVGVGVGLGVSTPLSLAR 482
            | .|   |..|:....|...  |....:.|...::||.|.:.....:..|:...|..||.:|.:.
  Fly   287 C-QGCELPSDDIPDSTSNSR--GHNNNTPSATNNNPSAGNLTPNSSLETGISSNLMGSTTVSASN 348

  Fly   483 SI 484
            .|
  Fly   349 VI 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 32/50 (64%)
pbNP_476669.3 COG5576 168..274 CDD:227863 44/116 (38%)
Homeobox 202..254 CDD:278475 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.