DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and nkx1.2la

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_997995.2 Gene:nkx1.2la / 405755 ZFINID:ZDB-GENE-040615-1 Length:270 Species:Danio rerio


Alignment Length:218 Identity:72/218 - (33%)
Similarity:99/218 - (45%) Gaps:42/218 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 NPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDI--SLTMSPRNYNGEM 272
            |.|...|:|          :::|.||          |.:.|.:||...|.  .:.:.|.:.:.:.
Zfish    48 NTGFGSLEE----------SRNGKHS----------DGECESTGDRSDDRHGCVRLHPPDPDVDF 92

  Fly   273 DKSRNGAYTNSDSEDCSD-DEGAQSRHEGGGMG-GKDSQGNGSSSNSKSRRRRTAFTSEQLLELE 335
            |.|.:.....|....|.| ||.|:.|....... .:..:.....|.:|.||.|||||.|||:.||
Zfish    93 DCSSSHRSLKSGFSPCEDPDEAAEERMTPAPDDVSRQRRRRSDHSCAKPRRARTAFTYEQLVALE 157

  Fly   336 REFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGL-TSHGLGRN---------G 390
            .:|.|.:|||:.||..:|.||.|:|.||||||||||.|||:...|: :|...|.|         |
Zfish   158 NKFRATRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGVESSLQAGTNSLPNISPSCG 222

  Fly   391 TTS--------GTKIVVPIPVHV 405
            :.|        |..|....|||:
Zfish   223 SASALHPPFSTGNMIFHSGPVHL 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 32/50 (64%)
nkx1.2laNP_997995.2 Homeobox 145..197 CDD:278475 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.