Sequence 1: | NP_477146.1 | Gene: | unpg / 35942 | FlyBaseID: | FBgn0015561 | Length: | 485 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_991238.1 | Gene: | pitx3 / 402974 | ZFINID: | ZDB-GENE-041229-4 | Length: | 293 | Species: | Danio rerio |
Alignment Length: | 201 | Identity: | 60/201 - (29%) |
---|---|---|---|
Similarity: | 93/201 - (46%) | Gaps: | 39/201 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 274 KSRNGAYTNSDS-----------EDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFT 327
Fly 328 SEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR----VKAGLTSHGLGR 388
Fly 389 --NGTTSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLSGPKPDLRKKLSAEAIGGFEKFSGSTNAS 451
Fly 452 SPSGGP 457 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
unpg | NP_477146.1 | Homeobox | 324..375 | CDD:278475 | 24/50 (48%) |
pitx3 | NP_991238.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..69 | 18/64 (28%) | |
Cnd2 | 18..>79 | CDD:303063 | 23/66 (35%) | ||
Homeobox | 64..116 | CDD:278475 | 25/51 (49%) | ||
OAR | 251..268 | CDD:281777 | |||
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 | 255..268 | ||||
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:O35160 | 260..264 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X14 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |