DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and LMX1B

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001167617.1 Gene:LMX1B / 4010 HGNCID:6654 Length:406 Species:Homo sapiens


Alignment Length:131 Identity:38/131 - (29%)
Similarity:53/131 - (40%) Gaps:22/131 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 CSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSS 315
            |.||             |..|.|...:.:...|||....|::|.....:|.|     ||..||..
Human   165 CKGD-------------YEKEKDLLSSVSPDESDSVKSEDEDGDMKPAKGQG-----SQSKGSGD 211

  Fly   316 NSKSRRR----RTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376
            :.|..||    ||..|::|....:..|..........|..:|....||...|::||||:|||.|:
Human   212 DGKDPRRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKK 276

  Fly   377 V 377
            :
Human   277 L 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 16/50 (32%)
LMX1BNP_001167617.1 LIM1_Lmx1b 56..108 CDD:188757
LIM2_Lmx1a_Lmx1b 115..169 CDD:188764 3/16 (19%)
Homeobox 222..275 CDD:278475 17/52 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.