DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and LMX1A

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001167540.1 Gene:LMX1A / 4009 HGNCID:6653 Length:382 Species:Homo sapiens


Alignment Length:249 Identity:53/249 - (21%)
Similarity:78/249 - (31%) Gaps:99/249 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 CSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMG----GKDSQGN 311
            |.||             |..|.:.....:...|||....|:|.......|.|.|    |||    
Human   144 CKGD-------------YEKERELLSLVSPAASDSGKSDDEESLCKSAHGAGKGTAEEGKD---- 191

  Fly   312 GSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR 376
                :.:.:|.||..|::|....:..|..........|..:|....||...|::||||:|||.|:
Human   192 ----HKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKK 252

  Fly   377 VKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLSGPKPDLRKKLSAEAIGGF 441
            :                               |.|.|.||.::        ...::||       
Human   253 L-------------------------------ARRQQQQQQDQ--------QNTQRLS------- 271

  Fly   442 EKFSGSTNASSPSGGPVGLGVGVGVGVGVGLGVSTP----------LSLARSIY 485
               |..||    .||..|:.           |:..|          |::.:|:|
Human   272 ---SAQTN----GGGSAGME-----------GIMNPYTALPTPQQLLAIEQSVY 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 16/50 (32%)
LMX1ANP_001167540.1 LIM1_Lmx1a 35..86 CDD:188756
LIM2_Lmx1a_Lmx1b 94..148 CDD:188764 3/16 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..208 16/54 (30%)
Homeobox 198..252 CDD:395001 17/53 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..285 13/96 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.