DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and hoxb9

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_988879.1 Gene:hoxb9 / 394474 XenbaseID:XB-GENE-963094 Length:247 Species:Xenopus tropicalis


Alignment Length:288 Identity:77/288 - (26%)
Similarity:105/288 - (36%) Gaps:76/288 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 YLPSSPAGHPAAQQPQAQAQPQPPPPHPPTHALEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLS 173
            |...|.....:.:.|.|:...|.|.|.|..|:...:       |||.....|.|.|.        
 Frog    10 YFVESIISPESEEAPAAKFSGQYPSPRPAAHSAHSE-------PLDFPSCSFQPKAP-------- 59

  Fly   174 YRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAH-----SSPAKSGS 233
                        |.|.|......|.|:                  |.|...|     .:|...|.
 Frog    60 ------------VFSASWSPLNPHPAS------------------PLPSVYHPYIQQGAPTPEGR 94

  Fly   234 H-----SPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEG 293
            :     .|::.|      |:....|...|: .|...|    ||:||.....| |..|....:|..
 Frog    95 YLRGWLEPLQRA------ENGPGQGTVKSE-PLLGPP----GELDKLGAQQY-NLGSPAAREDAN 147

  Fly   294 AQSRH------EGGGMGGKDSQGNGSSS---NSKSRRRRTAFTSEQLLELEREFHAKKYLSLTER 349
            .::..      ||.|...:..|.|.|::   ...||::|..:|..|.||||:||....||:...|
 Frog   148 ERATFPDNKLCEGSGDKDRTHQSNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRR 212

  Fly   350 SQIATSLKLSEVQVKIWFQNRRAKWKRV 377
            .::|..|.|||.||||||||||.|.|::
 Frog   213 HEVARLLNLSERQVKIWFQNRRMKMKKL 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 27/50 (54%)
hoxb9NP_988879.1 Hox9_act 1..169 CDD:368024 43/215 (20%)
Homeobox 185..239 CDD:365835 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.