DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and CG34031

DIOPT Version :10

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster


Alignment Length:74 Identity:37/74 - (50%)
Similarity:50/74 - (67%) Gaps:10/74 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 RRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTS- 383
            |:.|.|:::.||..||.||:..||||:::|.:::.||.|:|||||.||||||.|||:   .||| 
  Fly   134 RKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKK---QLTSR 195

  Fly   384 ------HGL 386
                  |||
  Fly   196 LKIAHRHGL 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeodomain 324..376 CDD:459649 28/51 (55%)
CG34031NP_001246894.1 Homeodomain 134..190 CDD:459649 30/55 (55%)

Return to query results.
Submit another query.