DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Awh

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster


Alignment Length:136 Identity:41/136 - (30%)
Similarity:59/136 - (43%) Gaps:23/136 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 GGKDSQGNGSSSN----SKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVK 364
            ||..|...|...:    ||::|.||.||.|||..|:..|.........:..:||:...||:...:
  Fly   129 GGTTSSDEGCDGDGYHKSKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLSKRVTQ 193

  Fly   365 IWFQNRRAKWKR-VKAGLTSHGLGRNGTTSGTKIVVP----IPVHVN-RFAVRSQHQQLEKMCLS 423
            :||||.||:.|: :.|       |:|      ||..|    ...|:| :.....|:.....|.|:
  Fly   194 VWFQNSRARQKKHIHA-------GKN------KIREPEGSSFARHINLQLTYSFQNNAQNPMHLN 245

  Fly   424 GPKPDL 429
            |.|..|
  Fly   246 GSKAGL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 18/50 (36%)
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759
LIM2_AWH 69..123 CDD:188765
Homeobox 152..204 CDD:278475 19/51 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.