DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and emx1

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_937787.1 Gene:emx1 / 378964 ZFINID:ZDB-GENE-031007-7 Length:231 Species:Danio rerio


Alignment Length:231 Identity:67/231 - (29%)
Similarity:93/231 - (40%) Gaps:69/231 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 LQEPTPPQA--HSSPAKS---GSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPR--------- 266
            |::|..|.|  :|:||.|   |..||...||....:..|   .::.:...|:|.|.         
Zfish    24 LEDPIRPTALSYSAPADSFLNGYQSPAGRALYPNPELVF---SETVNHAPLSMHPHQLGSAPLQH 85

  Fly   267 -NYNGEMDKS---------RNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNS---- 317
             ::.|...:.         ||..:                        |...|||..|.::    
Zfish    86 PHFFGTQHREPLNFYPWVLRNRFF------------------------GHRFQGNDVSQDTLLLH 126

  Fly   318 -----KSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRV 377
                 |.:|.||||:..|||.|||.|....|:...||.|:|.||.|||.|||:||||||.|:||.
Zfish   127 GPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLANSLSLSETQVKVWFQNRRTKYKRQ 191

  Fly   378 KAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQ 413
            |  |...|........|..       |:||:.:.::
Zfish   192 K--LEEEGPECTQKKKGNH-------HINRWRIATK 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 30/50 (60%)
emx1NP_937787.1 COG5576 82..>192 CDD:227863 43/133 (32%)
Homeobox 137..189 CDD:278475 31/51 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..231 6/33 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.