DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and PHDP

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster


Alignment Length:187 Identity:54/187 - (28%)
Similarity:82/187 - (43%) Gaps:38/187 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 DEDFECSGDSCSDISLTMSPRNYNGEMDKS-----RNGAYTNSDSEDCS--------DDEGAQSR 297
            :.:|..||.:...:|:.....:||..:|.|     ...|...|.:::.|        ..|...:.
  Fly    20 NSEFYNSGANGGGLSVANHINHYNLMIDSSYKLCANESAIRGSLNQESSLLFSKITTVSEFYPAT 84

  Fly   298 HEGGGMG--------GKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIAT 354
            |..|...        |.|  |...:..||.||.||.|||.||.|||:.|....|..:..|.:||:
  Fly    85 HNIGSYNTDFHLKSYGDD--GLSLTDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIAS 147

  Fly   355 SLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGL-----------GRNGTTSGTKIVVP 400
            .|.|:|.:|::||||||||:::.:    .|.:           ||....:|:|.:.|
  Fly   148 KLHLTEARVQVWFQNRRAKFRKQE----RHAIYIMKDKSSKLDGRKNPVAGSKYLGP 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 26/50 (52%)
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I2937
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.