DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and otp

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001286654.1 Gene:otp / 37364 FlyBaseID:FBgn0015524 Length:416 Species:Drosophila melanogaster


Alignment Length:223 Identity:65/223 - (29%)
Similarity:91/223 - (40%) Gaps:61/223 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 GAQSRHEGGGM--------GGKDSQGNGSSSN--------------------SKSRRRRTAFTSE 329
            |....|..||:        ||..|.|||:.:|                    :|.:|.||.||..
  Fly    62 GVARLHISGGLCDNSNALNGGNGSSGNGNGNNNNGNGNNNNSMQQQDQHLDKNKQKRHRTRFTPA 126

  Fly   330 QLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVK----------AGLTSH 384
            ||.||||.|....|..:..|.:||..:.|:|.:|::||||||||||:.|          |.|.||
  Fly   127 QLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRTPGALLPSH 191

  Fly   385 GLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLSGPKPDLRKKLSAEAI-GGFEKFSGST 448
            ||            .|...::...|:.      :.:|.:|.....|..:....: .||    |..
  Fly   192 GL------------PPFGANITNIAMG------DGLCGTGMFGGDRWSVGVNPMTAGF----GQL 234

  Fly   449 NASSPSGGPVGLGVGVGVGVGVGLGVST 476
            |.|||....:..|:..|:.:|..||..:
  Fly   235 NQSSPLSSSLNSGLNSGINMGSALGAGS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 25/50 (50%)
otpNP_001286654.1 Homeobox 119..167 CDD:278475 21/47 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.