DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Alx3

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001007013.2 Gene:Alx3 / 365900 RGDID:1359270 Length:343 Species:Rattus norvegicus


Alignment Length:331 Identity:82/331 - (24%)
Similarity:111/331 - (33%) Gaps:112/331 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 PAGHPAA----QQPQAQAQPQPPP---PHPPTHALEKQLP------PTLPHPLDTRFLPFNPAA- 164
            ||..|.|    :.|..|..|...|   |.||......:.|      |.||.|.       .|.| 
  Rat    13 PAAGPYAAARDEAPGPQGTPDAAPHLRPAPPRGPRLSRFPACGPLEPYLPEPA-------KPPAK 70

  Fly   165 ----AGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAH 225
                .|..|          ::|..:.:..|..|            |::|:...:..|  .|....
  Rat    71 YLQDLGPGP----------VLNGGHFYKGSSEA------------EEKASKAASFPQ--LPVDCR 111

  Fly   226 SSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSD 290
            ..|....|:....|             |...:.:|:.:||                         
  Rat   112 GGPRDGPSNVQGSP-------------GPCLASLSVPLSP------------------------- 138

  Fly   291 DEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATS 355
                         |..||. ..:.|.||.||.||.|::.||.|||:.|....|..:..|.|:|..
  Rat   139 -------------GLPDSM-ELAKSKSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALR 189

  Fly   356 LKLSEVQVKIWFQNRRAKW-KRVKAGLTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEK 419
            ..|:|.:|::||||||||| ||.:.|....  |||..|:...|.| :|       ....|.||:.
  Rat   190 TDLTEARVQVWFQNRRAKWRKRERYGKIQE--GRNPFTTAYDISV-LP-------RTDSHPQLQN 244

  Fly   420 MCLSGP 425
            ...|.|
  Rat   245 SLWSSP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 24/51 (47%)
Alx3NP_001007013.2 Homeobox 157..210 CDD:395001 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.