DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Nkx2-6

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001121125.1 Gene:Nkx2-6 / 364418 RGDID:1306149 Length:213 Species:Rattus norvegicus


Alignment Length:153 Identity:51/153 - (33%)
Similarity:72/153 - (47%) Gaps:31/153 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 RRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAG---- 380
            |:.|..|:..|:|.|||.|..::|||..||..:|:.|:|:..||||||||||.|.||.:..    
  Rat    51 RKPRVLFSQAQVLALERRFKQQRYLSAPEREHLASVLQLTSTQVKIWFQNRRYKCKRQRQDQTLE 115

  Fly   381 LTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLE-KMCLSGPKPDLRKKLSAEA----IGG 440
            |..|.|      :..::.||:.|             |: |.||.   ||.....|..|    ...
  Rat   116 LAGHPL------APRRVAVPVLV-------------LDVKPCLD---PDRHAFPSPYATTVLYSC 158

  Fly   441 FEKFSGSTNASSPSGGPVGLGVG 463
            |..::|:..::|.:|...|.|.|
  Rat   159 FSSYTGTPYSASYAGRYTGAGPG 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 26/50 (52%)
Nkx2-6NP_001121125.1 Homeobox 53..107 CDD:395001 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.