DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Gsx2

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001131035.2 Gene:Gsx2 / 364140 RGDID:1308047 Length:305 Species:Rattus norvegicus


Alignment Length:249 Identity:73/249 - (29%)
Similarity:90/249 - (36%) Gaps:92/249 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 PHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMHEDQ-ANPGM 213
            |.|.|.:|.|                |::             ||...|.|.....|..| ..||.
  Rat   111 PGPGDAQFCP----------------RVS-------------HAHHHHHAPQHHHHHHQPQQPGS 146

  Fly   214 AQLQEPTPPQAHSSPAKSG---SHSPMEPALDVGMDEDFECSGDSCSDISLTMS-PRNYNGEMDK 274
            |.........|.::.|..|   .|:|:                  |:..:..:| ||.::     
  Rat   147 AAAAAAAAAAAAAAAAALGHPQHHAPV------------------CAATTYNVSDPRRFH----- 188

  Fly   275 SRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFH 339
                         |..            |||.|     :|.....:|.||||||.|||||||||.
  Rat   189 -------------CLT------------MGGSD-----TSQVPNGKRMRTAFTSTQLLELEREFS 223

  Fly   340 AKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAGLTSHGLGRNGTTS 393
            :..|||...|.:|||.|.|||.||||||||||.|.|:     ...|..||...|
  Rat   224 SNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKK-----EGKGASRNNHAS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 36/50 (72%)
Gsx2NP_001131035.2 Homeobox 207..260 CDD:395001 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.