DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unpg and Meox1

DIOPT Version :9

Sequence 1:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001102307.1 Gene:Meox1 / 363684 RGDID:1308911 Length:253 Species:Rattus norvegicus


Alignment Length:274 Identity:87/274 - (31%)
Similarity:108/274 - (39%) Gaps:76/274 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 PQPPPP------HPPTHALEKQLPPTLPHPLDTRFLPFN-------PAAAGVAPTDLSYRRLAEL 180
            ||||.|      :|  |: |......|||...|   ||:       ||.|  |..|.|...||..
  Rat    12 PQPPAPVWGCLRNP--HS-EGSSASGLPHYPPT---PFSFHQKSDFPATA--AYPDFSTSCLAAT 68

  Fly   181 MNQDYVHSLSVHARLQHMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGM 245
                 .|||         ..|.|:..:| :|..     |..|..|...:::|..           
  Rat    69 -----PHSL---------PRAERIFNEQ-HPAF-----PQTPDWHFPISEAGQR----------- 102

  Fly   246 DEDFECSGDSCSDISLTMSPRNYNGEMDKSRNGAY--TNSDSEDC-------SDDEGAQSRHEGG 301
                           |.:.|.....||.....|..  |....|||       .:.|...||.:..
  Rat   103 ---------------LNLGPAGSAREMGAGSPGLVDGTGGLGEDCMVLGTIAHETEKKLSRRKKE 152

  Fly   302 GMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIW 366
            .....::.|.....:||:|:.|||||.|||.|||.||....||:...|.:||.:|.|||.|||:|
  Rat   153 RSDNPENGGGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVW 217

  Fly   367 FQNRRAKWKRVKAG 380
            |||||.||||||.|
  Rat   218 FQNRRMKWKRVKGG 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unpgNP_477146.1 Homeobox 324..375 CDD:278475 31/50 (62%)
Meox1NP_001102307.1 COG5576 139..251 CDD:227863 45/93 (48%)
Homeobox 174..227 CDD:395001 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.